DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG16710

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:429 Identity:118/429 - (27%)
Similarity:169/429 - (39%) Gaps:122/429 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLGTFVLI--------SCSSVEAAVTVGRACKVTDTMPGICRTSSDCEPLIDGYIKSGVLTLND 63
            |:|.|.:|:        .|:..|..:::.|...:...:.....|.::.....|.|          
  Fly    12 LVLHTQLLMYLAESEYPPCNLDEKCISLARCTSLLPFLKPHNMTPAEKAVFEDRY---------- 66

  Fly    64 VPSCGLGAWGE------IFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAV 122
               ||.|..|:      :.|||                         ..|.:         .|..
  Fly    67 ---CGYGPKGQELLDRVLICCP-------------------------NMGHI---------LPNT 94

  Fly   123 AACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDF-------RCGGSLIASR 180
            ..|..|..          ...|.||....|...|.||.|.|.......       ||.||||.:|
  Fly    95 QICGPIMP----------AYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNR 149

  Fly   181 FVLTAAHCVNTDANTPAFVRLGAVNI-ENPD--------------HSYQDIVIRSVKIHPQYV-- 228
            :|||||||:.........||||..|| .|||              |...|:.: |:| |..|:  
  Fly   150 YVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDL-SIK-HRHYMVF 212

  Fly   229 -GNKYNDIAILELERDVVETDNIRPACLHTD--ATDPP-SNSKFFVAGWGVLNVTTRARSKILLR 289
             ...|||||:|.|:..|..|..|:|.|:..|  .::|. ||.|..:||||:.:  .:..|.:||:
  Fly   213 EERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSH--KQGYSNVLLQ 275

  Fly   290 AGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA--IDQKLIADACKGDSGGPL--IHELNVE 350
            |.:.....|:|::|   :| |:.|.|    ::.:||  :...   |.|||||||||  |.|...|
  Fly   276 AYVNGRNADECSLS---EP-SLGLDK----ETHICAGNLGGN---DTCKGDSGGPLMAIMERGDE 329

  Fly   351 DGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVW 389
            :.:| :.|:.|.|:......|..||:.|.   |:|.|:|
  Fly   330 EFVY-LAGITSYGYSQCGYGPAAYTKTSK---FVEWILW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 8/54 (15%)
Tryp_SPc 143..384 CDD:214473 93/272 (34%)
Tryp_SPc 144..387 CDD:238113 95/274 (35%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 8/61 (13%)
Tryp_SPc 105..362 CDD:214473 95/275 (35%)
Tryp_SPc 106..362 CDD:238113 95/274 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.