DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG31219

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:401 Identity:106/401 - (26%)
Similarity:162/401 - (40%) Gaps:128/401 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TSSDCEPLIDGYIKSGVLTLNDVP---SCG----------LGAW---GEIFCCPTKPCCDNSTIT 90
            |:|||.| .:.|:     .|.:.|   :.|          :.||   |:..|||.          
  Fly    21 TNSDCYP-GEKYV-----YLYECPHVYTAGRSRTLMREYDMDAWLLFGQRICCPP---------- 69

  Fly    91 SVSTSSTTSTKAPMTSGRVDVPTFGSGDR-PAVAACKKIRERKQQRSGNQL-VIHIVGGYPVDPG 153
                                     .|:| |:...|           |..| ...:|||....|.
  Fly    70 -------------------------PGNRLPSTEIC-----------GQSLSTYRMVGGSEARPN 98

  Fly   154 VYPHMAAIGYITFGT----DFRCGGSLIASRFVLTAAHCVN---TDANTPAFVRLGAVNIE---- 207
            .||.||.:.|:...|    .| |.||||.:|:|||:|||||   .|.:..: ||||..:|.    
  Fly    99 GYPWMAMLLYLNTTTLEILPF-CAGSLINNRYVLTSAHCVNGIPRDLSLKS-VRLGEHDITYDPA 161

  Fly   208 -NPDHSYQD---------IVIRSVKIHPQY--VGNK---YNDIAILELERDVVETDNIRPACLHT 257
             |||...||         |.:..:.:|..:  :.|:   | |||:|.|:..|.....|.|.|:  
  Fly   162 YNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEY-DIALLRLKMPVRYRTGIMPICI-- 223

  Fly   258 DATDPP----SNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQC--NISYAEQPGSIRLLKQ 316
                |.    :.||..:||||..|  ....|::|:...:....:..|  ...|.:...|:::...
  Fly   224 ----PKHGFFAKSKLEIAGWGKTN--EGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAG 282

  Fly   317 GVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGF-GCATV-TPGLYTRVSS 379
            | .|.:          |.|:|||||||:  :.:::....:.|:.:.|. .|..: .||:|||.|:
  Fly   283 G-YDGV----------DTCQGDSGGPLM--VTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSA 334

  Fly   380 YLDFIEGIVWP 390
            :|.:|:.::.|
  Fly   335 FLPWIKAVLRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 13/52 (25%)
Tryp_SPc 143..384 CDD:214473 83/274 (30%)
Tryp_SPc 144..387 CDD:238113 84/276 (30%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 83/274 (30%)
Tryp_SPc 90..342 CDD:238113 84/275 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.