DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG5255

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:251 Identity:78/251 - (31%)
Similarity:115/251 - (45%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI-- 206
            ||||.....|:.|:..::..|..|. ..|||::|..|:::|||||......|...|..|..::  
  Fly    30 IVGGEEAAAGLAPYQISLQGIGSGA-HSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQ 93

  Fly   207 ENPDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFV 270
            ....:.|.|.::.    |..|...|| ||||:|.|...:|..:..:|..|..:|..|  .|:..:
  Fly    94 NGSKYYYPDRIVE----HSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVP--GSRLLL 152

  Fly   271 AGWGVL----NVTTRARSKILLRAGLEL--VPLDQCNISYAEQPGSIRLLKQGVID-SLLCAIDQ 328
            .|||.|    :|..|.:|       ||:  ||.:||.   |....|.|      :| ..:|..:.
  Fly   153 TGWGTLSLGGDVPARLQS-------LEVNYVPFEQCR---AAHDNSTR------VDIGHVCTFND 201

  Fly   329 KLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFI 384
            | ...||.|||||||:|     :|  .::.:::.|..||...|..:..:|.|.|||
  Fly   202 K-GRGACHGDSGGPLVH-----NG--KLVALVNWGLPCAKGYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 76/249 (31%)
Tryp_SPc 144..387 CDD:238113 78/251 (31%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/249 (31%)
Tryp_SPc 30..252 CDD:238113 78/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437647
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.