DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG17475

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:258 Identity:75/258 - (29%)
Similarity:110/258 - (42%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAI-----GYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRL-- 201
            ::.|..|..|...:..::     |:|       |||.:|..|.||||||||.  ...|.::|:  
  Fly    50 VINGEDVQLGEAKYQISLQGMYGGHI-------CGGCIIDERHVLTAAHCVY--GYNPTYLRVIT 105

  Fly   202 GAVNIENPDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPPSN 265
            |.|..|.||..|   .:....||..|....| ||||::.|...:...:..:||.|   .|.|.:|
  Fly   106 GTVEYEKPDAVY---FVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAEL---PTAPVAN 164

  Fly   266 -SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQC----NISYAEQPGSIRLLKQGVIDSLLCA 325
             ::..:.|||...:.... ..||.:|.|..|....|    |...:..|..|..|..|.       
  Fly   165 GTQLLLTGWGSTELWGDT-PDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGG------- 221

  Fly   326 IDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIV 388
                  ..||.|||||||.|     :|:  :.|:::.|:.||...|..:..|..||::|..::
  Fly   222 ------QGACHGDSGGPLTH-----NGV--LYGLVNWGYPCALGVPDSHANVYYYLEWIRSMI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 74/252 (29%)
Tryp_SPc 144..387 CDD:238113 75/255 (29%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 74/252 (29%)
Tryp_SPc 50..269 CDD:238113 75/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.