DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG17477

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:106/262 - (40%) Gaps:62/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208
            ||||.....|..|:..::..: .|:.. |||::|:.|:::||.|||.....:...|..|.:....
  Fly    27 IVGGQNAAEGDAPYQVSLQTL-LGSHL-CGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAE 89

  Fly   209 PDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPPSN------S 266
            |...|..   .::.:|..|...|| |||.:|.|...:  |.|..     |.|.:.|::      |
  Fly    90 PGAVYYP---DAIYLHCNYDSPKYQNDIGLLHLNESI--TFNAL-----TQAVELPTSPFPRGAS 144

  Fly   267 KFFVAGWGVLNVTTRARSKI--------------LLRAGLELVPLDQCNISYAEQPGSIRLLKQG 317
            :....|||..:......|::              .:.:..|.:.|..|:|               
  Fly   145 ELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHI--------------- 194

  Fly   318 VIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLD 382
                  ||..|..|. ||.|||||||:|:       .|::|:::....||...|.::..:..|.|
  Fly   195 ------CAYRQANIG-ACHGDSGGPLVHQ-------GTLVGILNFFVPCAQGVPDIFMNIMYYRD 245

  Fly   383 FI 384
            ::
  Fly   246 WM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 65/260 (25%)
Tryp_SPc 144..387 CDD:238113 65/262 (25%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 65/262 (25%)
Tryp_SPc 27..246 CDD:214473 64/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.