DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and modSP

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:406 Identity:103/406 - (25%)
Similarity:152/406 - (37%) Gaps:120/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TDTMP---GICRTSSDCEPLIDGYIKSGVLTLNDVPSCGLGAWGEIFCCPTKPCCDNSTITSVST 94
            |.|:|   ..|.|:.:    .|||....:.|.|          |:...| .||.....|......
  Fly   277 TSTIPKCVKYCSTAGE----FDGYSTKALCTHN----------GQQVEC-RKPFHPPGTEVKFVC 326

  Fly    95 SSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKK------IRERKQQRSGNQLVIHI----VGGYP 149
            |:...|.:|:...|                |.|      .|:|.:|..| ||...|    .|||.
  Fly   327 STGFKTLSPLPEMR----------------CMKGGYWNRGRQRCEQDCG-QLATPIKQFSSGGYT 374

  Fly   150 VDPGVYP-HMAAIGYITFGTD----FRCGGSLIASRFVLTAAHCVNTDA-----NTPAFVRLGAV 204
            ::..|.| |   :|...:..:    |:|||||:....|:||||||..:.     :...|..:.|.
  Fly   375 INNTVVPWH---VGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAK 436

  Fly   205 NIEN-----PDHSYQDIVIRSVKIHPQYVG---NKYNDIAILELERDVVETDNIRPACL------ 255
            ...|     |:...:|  :|.::|.|.|.|   |.|.|:|:|.|:.....:..|||.|:      
  Fly   437 FYRNYGETTPEEKRRD--VRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFA 499

  Fly   256 HTDATDPPSNSKFFVAGWGVLN------VTTRARSKILLRAGLELVPLDQ-CNISYAEQPGSIRL 313
            ..::.......||  |||.:.|      |...::|..:.|..|..:..|: |            :
  Fly   500 EKESVTDDVQGKF--AGWNIENKHELQFVPAVSKSNSVCRRNLRDIQADKFC------------I 550

  Fly   314 LKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNV------EDGMYTIMGVISSGFG---CA-T 368
            ..||  .||           ||:|||||....||..      ....:.:.||||:...   || :
  Fly   551 FTQG--KSL-----------ACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHS 602

  Fly   369 VTPGLYTRVSSYLDFI 384
            :|  :.|.:..:.|.|
  Fly   603 LT--VMTNIQHFEDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 11/48 (23%)
Tryp_SPc 143..384 CDD:214473 75/285 (26%)
Tryp_SPc 144..387 CDD:238113 76/286 (27%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 3/6 (50%)
Sushi 309..354 CDD:278512 11/61 (18%)
Tryp_SPc 371..616 CDD:214473 74/278 (27%)
Tryp_SPc 371..591 CDD:304450 67/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.