DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG31326

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:358 Identity:93/358 - (25%)
Similarity:141/358 - (39%) Gaps:78/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GVLTLNDVPSCGLGAWGEIFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGR--VD-VPTFGSGD 118
            |:.:..::||          ..|.:|           |.:.:.:.||..:.|  || ||.    .
  Fly   215 GITSQPEIPS----------PVPQRP-----------TPNPSRSNAPQQAVRSPVDLVPQ----Q 254

  Fly   119 RPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITF------GTDFRCGGSLI 177
            .|:.......|||   .|...|:..   |..:..|..|.:.||    |      |..|.|||:||
  Fly   255 NPSSNGIPCGRER---ASTTPLIFQ---GKSLQRGQLPWLVAI----FERRESNGPAFICGGTLI 309

  Fly   178 ASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVK---IHPQYVGNKYN--DIAI 237
            ::..||:||||...........||......|....:.|...|.|.   ||..:...::.  |:|:
  Fly   310 STSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLAL 374

  Fly   238 LELERDVVETDNIRPACLHTDAT--DPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQC 300
            :.|:..|..||.|.|.||.:.:.  |.|...|.:|||||. :.|....:::.....|.:|....|
  Fly   375 VRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGP-DETGTGNTEVSKVTDLNIVSEANC 438

  Fly   301 NISYAE---QPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISS 362
            .:....   ||.|            |||  :|..|..|..|.||||:..   |..::.:.||||.
  Fly   439 ALELPHVLVQPSS------------LCA--KKTGAGPCASDGGGPLMLR---EQDVWVLRGVISG 486

  Fly   363 GF------GCATVTPGLYTRVSSYLDFIEGIVW 389
            |.      .|....|.::|.|:.:::::...:|
  Fly   487 GVINEKENTCELSKPSVFTDVAKHIEWVRQKMW 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 3/21 (14%)
Tryp_SPc 143..384 CDD:214473 73/262 (28%)
Tryp_SPc 144..387 CDD:238113 73/264 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 73/261 (28%)
Tryp_SPc 277..514 CDD:214473 73/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.