DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and snk

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:392 Identity:125/392 - (31%)
Similarity:187/392 - (47%) Gaps:60/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSVEAAVTVGRACKVT-DTMPGICRTSSDCEPLIDGYIKSG----VLT-LNDVPSCGLGAWGEIF 76
            :||...:..|..|:.: |...|.|..:..|..:|..|...|    :.| .|:||         :.
  Fly    81 TSVSEGLHEGAFCRRSFDGRSGYCILAYQCLHVIREYRVHGTRIDICTHRNNVP---------VI 136

  Fly    77 CCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLV 141
            |||..    :..:.:...|:|...:....:.|:.:...|                 :..||.|.|
  Fly   137 CCPLA----DKHVLAQRISATKCQEYNAAARRLHLTDTG-----------------RTFSGKQCV 180

  Fly   142 IH---IVGGYPVDPGVYPHMAAIGYITFGTDFR-------CGGSLIASRFVLTAAHCVNTDANTP 196
            ..   ||||.|...|::|||||:|: |.|:..:       |||:|::..:|||||||..:.:..|
  Fly   181 PSVPLIVGGTPTRHGLFPHMAALGW-TQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPP 244

  Fly   197 AFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNK-YNDIAILELERDVVETDNIRPACL-HTDA 259
            ..|||||..:.....:.|||.|..:.:||:|..:. |:|||:|:|.|.|..::.:||||| ....
  Fly   245 DMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPE 309

  Fly   260 TDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLC 324
            ...|:   ...||||.... ..|:|..|.:..|::||...|...|.::    |.|.:|:|:...|
  Fly   310 LQIPT---VVAAGWGRTEF-LGAKSNALRQVDLDVVPQMTCKQIYRKE----RRLPRGIIEGQFC 366

  Fly   325 AIDQKLIADACKGDSGGPLIHELNVE-DGMYTIMGVISSGFGCATV-TPGLYTRVSSYLDFIEGI 387
            |.......|.|:|||||| ||.|..| :.:..::|:.|.|..||.. .||:|||:.||||:||.|
  Fly   367 AGYLPGGRDTCQGDSGGP-IHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKI 430

  Fly   388 VW 389
            .:
  Fly   431 AF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 13/54 (24%)
Tryp_SPc 143..384 CDD:214473 96/254 (38%)
Tryp_SPc 144..387 CDD:238113 98/253 (39%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 13/54 (24%)
Tryp_SPc 186..430 CDD:238113 98/253 (39%)
Tryp_SPc 186..427 CDD:214473 96/250 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.