DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG11668

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:440 Identity:100/440 - (22%)
Similarity:172/440 - (39%) Gaps:123/440 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WSLLLGTFVLI----SCSSVEAAVTVGRACKVTDTMPGICRTSSDCEPLIDGYIKSGVLTLNDVP 65
            |:.:..:::.|    :|.:.:..: :|:..:..|     |.::....|.:...:         .|
  Fly    28 WNAVAPSYLSIDIYGNCQAHDRPL-IGKCVRYVD-----CISAMQAVPRVTPLL---------CP 77

  Fly    66 SCGLGAW-GEIFCCP-----TKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAA 124
            |    :| .::.|||     ..|                             |:....::....|
  Fly    78 S----SWPNQLVCCPHGGYLLPP-----------------------------PSISKSEQACANA 109

  Fly   125 CKKIRERKQQRSGN--------QLVIHI-----------VGGYPVDPGVYPHMAAIGYIT----- 165
            ..:...::::|..|        :||..|           |||.......:|:|.|:|:.:     
  Fly   110 YPRAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRW 174

  Fly   166 ---FGTD-----FRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVK 222
               .|:.     |.||.::||.||.:|||||.:....:|:...:|.|.:.:  ...|.|.|:.:.
  Fly   175 IHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELNS--GRGQLIEIKRIS 237

  Fly   223 IHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPP--------SNSKFFVAGWGVLNV 278
            .||.:..... ||:|:::|.|    ..::..|||....:.|.        ..:||  ||      
  Fly   238 QHPHFDAETLTNDLAVVKLAR----RSHMPVACLWNQESLPERPLTALGYGQTKF--AG------ 290

  Fly   279 TTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPL 343
               ..|..||:..|..:...||. .|..   :...|..|:....:||.|.....|.|:|||||||
  Fly   291 ---PHSSNLLQIMLYHLNFQQCQ-RYLH---NYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPL 348

  Fly   344 IHELNVEDGMYTI---MGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWP 390
            :...::....:||   :|:.|.|..||:..||:|.|::.|:.:||..|||
  Fly   349 LLHQHMRHHRHTIPYVVGITSFGGACASGQPGVYVRIAHYIQWIEQQVWP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 7/49 (14%)
Tryp_SPc 143..384 CDD:214473 75/276 (27%)
Tryp_SPc 144..387 CDD:238113 77/278 (28%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 76/266 (29%)
Tryp_SPc 149..392 CDD:214473 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRA1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.