DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG7542

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:259 Identity:74/259 - (28%)
Similarity:125/259 - (48%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 HIVGGYPVDPGVYPHMAAIGYITFGT-DFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI 206
            :|..|.|.:.|.:|:.|.:. ::||. ...|||:||:..:::|||||:  |......|.|||:||
  Fly    26 YITNGEPAEVGQFPYQAGLN-VSFGNWSTWCGGTLISHYWIITAAHCM--DGAESVTVYLGAINI 87

  Fly   207 ENPDHSYQDIVI---RSVKIHPQYVGNK-YNDIAILELERDVVETDNIRPACL--HTDATDPPSN 265
            .:.....|:.::   ..:.:|..|:.:. .|||:::.|...|..||.||.|.|  ..:...|...
  Fly    88 GDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYE 152

  Fly   266 S-KFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQK 329
            | :.|.:|||..:..:.:.|.:|....:.::|...|.:.::.                  |:.:|
  Fly   153 SIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSG------------------AVSEK 199

  Fly   330 LIA-------DACKGDSGGPLIHELNVEDGMYTIMGVISSG--FGCATVTPGLYTRVSSYLDFI 384
            :|.       ..|.|||||||:::   :.....::|..|.|  .||....|.::||:|||||:|
  Fly   200 MICMSTTSGKSTCHGDSGGPLVYK---QGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 73/257 (28%)
Tryp_SPc 144..387 CDD:238113 74/258 (29%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 74/258 (29%)
Tryp_SPc 27..260 CDD:214473 73/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437045
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.