DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG11529

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:235 Identity:77/235 - (32%)
Similarity:118/235 - (50%) Gaps:40/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 CGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVK--IHPQY-VGNKYN 233
            |||:|:..|::|||.||  |...|...|.||..::|:.:.| ..:|:||.|  :|.:: .....|
  Fly    59 CGGTLLDKRWILTAGHC--TMGVTHYDVYLGTKSVEDTEVS-GGLVLRSNKFIVHERFNPETAAN 120

  Fly   234 DIAILELERDVVETDNIRPACL-----HTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLE 293
            |||:::|.:||..|..|:||.|     |    |..:......:|||.:...|.:.|  :....|:
  Fly   121 DIALVKLPQDVAFTPRIQPASLPSRYRH----DQFAGMSVVASGWGAMVEMTNSDS--MQYTELK 179

  Fly   294 LVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIAD--ACKGDSGGPLIHELNVEDGMYTI 356
            ::...:|...|       .::..|||    ||   |.:.|  .|.|||||||:    ::| ...:
  Fly   180 VISNAECAQEY-------DVVTSGVI----CA---KGLKDETVCTGDSGGPLV----LKD-TQIV 225

  Fly   357 MGVISSG--FGCATVTPGLYTRVSSYLDFIEGIVWPDNRV 394
            :|:.|.|  .||.|..||.:|||:.|||:||..:....:|
  Fly   226 VGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHGQV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 74/223 (33%)
Tryp_SPc 144..387 CDD:238113 76/226 (34%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 76/226 (34%)
Tryp_SPc 37..255 CDD:214473 74/223 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.