DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG8329

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:290 Identity:77/290 - (26%)
Similarity:117/290 - (40%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTA 185
            |.....:.|.|.....|....| ||.|||...|..|:  |:| :........|||:|.:.:||||
  Fly    13 ATVCAHRNRNRTAHHGGGPKDI-IVNGYPAYEGKAPY--AVG-LRMNNGAVGGGSVIGNNWVLTA 73

  Fly   186 AHCVNTDANTPAFVRLGAVNIE-----NPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVV 245
            |||:.||:.|..:....|.|.:     |.::.::         ||.|..:..:||.::.      
  Fly    74 AHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNFFR---------HPGYPNSAGHDIGLIR------ 123

  Fly   246 ETDNIRPACLHTDATDPPSNSKF------------FVAGWGVLNVTTRARSKILLRAGLELVPLD 298
                 .|....|:..:..|..||            ...|||  .:.....:..|....::::...
  Fly   124 -----TPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWG--GMANGGLADWLQCMDVQVISNG 181

  Fly   299 QCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLI-HELNVEDGMYTIMGVISS 362
            :|..||    ||:     ...|....|.|.|.:   |.|||||.|: |:..::.|:.|...:   
  Fly   182 ECARSY----GSV-----ASTDMCTRATDGKSV---CGGDSGGALVTHDNPIQVGVITFASI--- 231

  Fly   363 GFGCATVTPGLYTRVSSYLDFI---EGIVW 389
              ||.: .|..|||||.:||:|   .||.:
  Fly   232 --GCKS-GPSGYTRVSDHLDWIREKSGIAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 69/258 (27%)
Tryp_SPc 144..387 CDD:238113 70/263 (27%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 70/260 (27%)
Tryp_SPc 35..250 CDD:214473 69/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.