DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG33460

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:245 Identity:60/245 - (24%)
Similarity:96/245 - (39%) Gaps:63/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 TFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVG 229
            |.|:.| |.|:||...|:||||.|:..:|   ..||||... ..|:...:|.::....::..:..
  Fly    51 TDGSIF-CAGTLITDVFILTAASCIRPNA---VKVRLGEFG-RYPNELPEDHLVHYFLMYRLFNN 110

  Fly   230 NKY-NDIAILELERDVVETDNIRPACLHTDATDPP-SNSKFFVAGWGVLNVTTRARSKILLRAGL 292
            ... |:|.:|:|.:.|..||.|.|.|:..:..:.. |..:|....|                   
  Fly   111 ESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW------------------- 156

  Fly   293 ELVPLDQCNISYAEQPGSIRLLKQGVIDS--LLCAIDQKLIADACKGDSGGPLIHELNVEDGMYT 355
                ::..|:|..::      |:..||.|  .:|. :..|....|.|..|     .|...||: |
  Fly   157 ----MEDSNVSLTKE------LRPIVIQSKPKMCT-NLDLYTQFCAGHQG-----NLRSCDGL-T 204

  Fly   356 IMGVISSG----------FGCATV-------TPGLYTRVSSYLDFIEGIV 388
            ...:|.:.          ||.|||       :.| ||.|..:..:|:.:|
  Fly   205 GSALIQNSRYMNKYRHIQFGIATVNDMDCEESQG-YTDVLKFYWWIQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 58/239 (24%)
Tryp_SPc 144..387 CDD:238113 59/242 (24%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 59/242 (24%)
Tryp_SPc 44..249 CDD:214473 58/239 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.