DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG33465

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:247 Identity:63/247 - (25%)
Similarity:102/247 - (41%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQD----- 215
            |.||:   |.....|.|.|:|:...||||||.|::.|:.  .:|..|..|      .|:|     
  Fly    46 PWMAS---IYKNNQFICDGTLVHKLFVLTAASCISKDSQ--LYVLFGMYN------QYRDASQFF 99

  Fly   216 --------IVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAG 272
                    :.::.....|   .|..|||.:|.|..:|....:|||.|:..|.....:..:.| .|
  Fly   100 NNEQYGVAVALQHSNFRP---NNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERF-EG 160

  Fly   273 WGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKG 337
            :|.....|.|.|::     .:.|.|.|.......:.|.:..:.:|    ..||.::.  ...|:.
  Fly   161 FGWQQQGTEASSQV-----RQTVYLSQKKPFECHRNGQLLPINEG----QFCAGNRD--RSFCRS 214

  Fly   338 DSGGPLIHELNVEDGMYTI-MGVISSGFGCATVTPGLYTRVSSYLDFIEGIV 388
            :||.||..:........|: :|::|.|....:.| .:||.|.::.|:|...|
  Fly   215 NSGSPLTADFTYGVKNITVQVGLVSYGSELCSPT-SVYTDVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 61/241 (25%)
Tryp_SPc 144..387 CDD:238113 62/244 (25%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/244 (25%)
Tryp_SPc 46..261 CDD:214473 61/241 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.