DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon65Ai

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:251 Identity:66/251 - (26%)
Similarity:102/251 - (40%) Gaps:44/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208
            |..|||...|..|::..:|:...|....||||:|.:.:|:||.||  ||......:..||  :..
  Fly    38 ITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHC--TDGMESVTIYYGA--LWR 98

  Fly   209 PDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKF----- 268
            ....|...|.||     .::.:...||::       :.|.::....|......|..:.::     
  Fly    99 LQAQYTHWVGRS-----DFIEHGSGDISL-------IRTPHVDFWSLVNKVELPRYDDRYNNYQG 151

  Fly   269 ---FVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKL 330
               .|:|||..: .....|:.|....:::.....|...|....|           .|:| |....
  Fly   152 WWALVSGWGKTS-DEGGVSEYLNCVDVQIGENSVCENYYGSFSG-----------DLIC-IPTPE 203

  Fly   331 IADACKGDSGGPLIHELNVEDGMYTIMGVIS--SGFGCATVTPGLYTRVSSYLDFI 384
            ....|.|||||||:    :.||...: |::|  |..||.:..|....||:||||:|
  Fly   204 NKGTCSGDSGGPLV----IHDGNRQV-GIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 65/249 (26%)
Tryp_SPc 144..387 CDD:238113 66/251 (26%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 65/249 (26%)
Tryp_SPc 41..257 CDD:238113 65/248 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436957
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.