DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon65Aii

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:288 Identity:73/288 - (25%)
Similarity:116/288 - (40%) Gaps:76/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYIT-FGTDFRCGGSLIASRFVLTA 185
            |||.::....|...:||::...|..|||...|..|::.|:.:.. .|..:.||||:|...:||||
  Fly    15 VAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTA 79

  Fly   186 AHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNI 250
            |||  |...:...:..|||..:.|..::.|            .||.:||||:       :.|.::
  Fly    80 AHC--TYGASYVTISYGAVWRQQPQFTHYD------------TGNLHNDIAL-------IRTPHV 123

  Fly   251 RPACLHTDATDPPSNSKF--------FVAGWG-------------VLNVTTRARSKILLRAGLEL 294
            ....|......|..:.::        .::|||             .:::.....|..|...|...
  Fly   124 DFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHY 188

  Fly   295 VPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLI-HELNVEDGMYTIMG 358
            :..:....:..|..||                        |.|||||||: |:.|.:      :|
  Fly   189 ITSNHLCYATPENKGS------------------------CSGDSGGPLVLHDGNRQ------VG 223

  Fly   359 VIS--SGFGCATVTPGLYTRVSSYLDFI 384
            ::|  |..||.:.:|...|||:.|||:|
  Fly   224 IVSFGSAAGCLSNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 66/265 (25%)
Tryp_SPc 144..387 CDD:238113 67/266 (25%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 66/265 (25%)
Tryp_SPc 37..254 CDD:238113 67/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436961
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.