DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:120/259 - (46%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVN-TDANT---PAFVRLGA- 203
            |..|.....|.:|:...:.:.:....:.||||:|.:.:|||||||.: ..|.|   .|.||..| 
  Fly    40 ITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQ 104

  Fly   204 ----VNIEN-PDH-SYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIR----PACLHTD 258
                |:.:| ..| ||..||:|             |||::::.. .|..|..|.    ||...|.
  Fly   105 LVQTVSADNFVQHASYNSIVLR-------------NDISLIKTP-TVAFTALINKVELPAIAGTY 155

  Fly   259 ATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLL 323
            :|  .:..:...:|||..:.:..:.:..|.....|:|.:.||..:|    ||:     ...::::
  Fly   156 ST--YTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTY----GSL-----VATNNVI 209

  Fly   324 CAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVIS--SGFGCATVTPGLYTRVSSYLDFIE 385
            |......:: .|.|||||||:   .|.|.  .::||.|  |..||.:..|..:|||:||||:|:
  Fly   210 CVATPNKVS-TCNGDSGGPLV---LVSDS--KLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 76/256 (30%)
Tryp_SPc 144..387 CDD:238113 77/259 (30%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 76/256 (30%)
Tryp_SPc 40..269 CDD:238113 77/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437033
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.