DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG3700

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:414 Identity:116/414 - (28%)
Similarity:170/414 - (41%) Gaps:91/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLGTFVLISCSSVEAAVTVGRACKVTDTMPGICR--TSSDCEPLIDGYIKSGVLTLNDVPSCGLG 70
            |.|..:|:..:|| :.||     :..|...|.|:  |.|||..:.......|.    :|..|  .
  Fly     4 LPGIQILLLIASV-SVVT-----EYCDNGTGECKELTPSDCPVIFYNQHLIGA----EVKYC--D 56

  Fly    71 AWGEIFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQR 135
            .:.:|.|||..  .|:..:.....:                       ||....||:..|   .|
  Fly    57 EFNDIVCCPIP--LDHQNLKPAEQT-----------------------RPFEKQCKQYNE---VR 93

  Fly   136 SGNQLVIHIVGGYPVDPGVYPHMAAIG-----YITFGTDFRCGGSLIASRFVLTAAHCVNTDA-- 193
            |..|....||||.......:|.||.||     ......::.||||::..:||||||||:.||.  
  Fly    94 SACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESK 158

  Fly   194 --------NTPAF-VRLGAV--NIENPDHSYQDIVIRSVKIHPQY------VGNKYNDIAILELE 241
                    ::|.| ||||.:  |....|...||..:.:..:||.|      .|.| ||||::||:
  Fly   159 AERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK-NDIALVELD 222

  Fly   242 RDVVETDNIRPACLHTDATDPPSN----SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNI 302
            |.....|::...||      ||.:    .:...||||.  .....:|..||:..|:....:.|. 
  Fly   223 RKAEFNDHVAAVCL------PPDSGNDVQQVTAAGWGF--TADGVKSSHLLKVNLQRFSDEVCQ- 278

  Fly   303 SYAEQPGSIRLLKQGV-IDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGC 366
                     :.|:..: ..:..||......||.|.||||||:..:..:...:..::|::|.|..|
  Fly   279 ---------KRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVC 334

  Fly   367 ATV-TPGLYTRVSSYLDFIEGIVW 389
            .:. .|.:||:|..|.|:||.|||
  Fly   335 GSQGLPSVYTKVHLYTDWIESIVW 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 12/50 (24%)
Tryp_SPc 143..384 CDD:214473 81/270 (30%)
Tryp_SPc 144..387 CDD:238113 83/272 (31%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/272 (31%)
Tryp_SPc 102..353 CDD:214473 81/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.