DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG30283

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:254 Identity:80/254 - (31%)
Similarity:120/254 - (47%) Gaps:38/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGT-DFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIE 207
            |:||:.......|.||.:    .|. .|.|||:||.:|||||:|||:   ||....||||.:..|
  Fly    43 ILGGHNAPVASAPWMAMV----MGEGGFHCGGTLITNRFVLTSAHCI---ANGELKVRLGVLERE 100

  Fly   208 NPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNS------ 266
               ...|...:.::.:|..|..::: |:|:|.|.:.|..:|||.|.||   ..||...:      
  Fly   101 ---AEAQKFAVDAMFVHTDYYFDQH-DLALLRLAKRVHYSDNISPICL---LLDPLVKNIDEHIV 158

  Fly   267 KFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLI 331
            ||...|||  ...:|:.|::|.:..|..:...:|...|..|.         :..:.:||  :...
  Fly   159 KFRTYGWG--KTESRSSSRMLQKTSLFNLHRSECAKQYPHQQ---------INRNHICA--ESAN 210

  Fly   332 ADACKGDSGGPLIHELNVED-GMYTIMGVISSGFG-CATVTPGLYTRVSSYLDFIEGIV 388
            |:.|.|||||||...:..:. .|....||.|.|.. |:..|  ::|.|.::||:|...|
  Fly   211 ANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKAT--VFTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 78/248 (31%)
Tryp_SPc 144..387 CDD:238113 79/251 (31%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 78/248 (31%)
Tryp_SPc 43..266 CDD:238113 79/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.