DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG10764

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:258 Identity:82/258 - (31%)
Similarity:128/258 - (49%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208
            |.||   |....|:...:..|...:||:|||::|..||||:||||:....:  .:|||||.||..
  Fly    38 ISGG---DDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYD--LYVRLGARNINE 97

  Fly   209 PDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPPSNSK---FF 269
            |...:   .:.:|.:|..::.::| |||.:|:|...:|.|..::|.|:..|.....|..|   |.
  Fly    98 PAAVH---TVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFR 159

  Fly   270 VAGWGVLNVTTRARSKILLRAGLELVPL--DQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIA 332
            ..|||..|    .:..|:|:. :.|:.|  ::|.          |.|...:....:||..:.  .
  Fly   160 ALGWGNRN----GKLSIMLQT-IYLLHLKRNECK----------RKLNFNLNSRQICAGTKN--G 207

  Fly   333 DACKGDSGGPLIHELNV---EDGMYTI-MGVISSGFG---CATVTPGLYTRVSSYLDFIEGIV 388
            |.|:|||||||  ..|:   .:..|.: :|::|  ||   |..|  |:||.|:||:|:|...:
  Fly   208 DTCRGDSGGPL--STNILFPSNKSYEVQLGIVS--FGDPECRGV--GVYTDVTSYVDWISSTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 81/252 (32%)
Tryp_SPc 144..387 CDD:238113 82/255 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 81/252 (32%)
Tryp_SPc 38..263 CDD:238113 82/255 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.