DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon44E

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:296 Identity:85/296 - (28%)
Similarity:130/296 - (43%) Gaps:61/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASR 180
            :|..|:.:| :.:..:...|:| ::...|..|||...|..|::..:.:...|  :.||||:|...
  Fly    15 AGVVPSESA-RAVPVKDMPRAG-KIEGRITNGYPAYEGKIPYIVGLSFNDGG--YWCGGSIIDHT 75

  Fly   181 FVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKI-HPQYVGNKYNDIAILELERDV 244
            :|||||||.|: || ...:..||  ....:..|...|.||..| ||.:.....||||::.:.   
  Fly    76 WVLTAAHCTNS-AN-HVLIYFGA--SFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRIP--- 133

  Fly   245 VETDNIRPACLHTDATD-------PPSNSKF--------FVAGWGVLNVTTRARSKILLRAGLEL 294
                       |.|...       |..|.::        ..:||| |.......|..|....:::
  Fly   134 -----------HVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWG-LTDNNSGMSNYLNCVDVQI 186

  Fly   295 VPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLI-HELNVEDGMYTIMG 358
            :..:.|...|    ||     ..:.|:.:| |:......:|.|||||||: |:.|      .|:|
  Fly   187 IDNNDCRNYY----GS-----NYITDNTIC-INTDGGKSSCSGDSGGPLVLHDNN------RIVG 235

  Fly   359 VIS--SGFGCATVTPGLYTRVSSYLDFIE---GIVW 389
            ::|  ||.||....|..:|||:.|||:|.   |||:
  Fly   236 IVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTGIVY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 76/259 (29%)
Tryp_SPc 144..387 CDD:238113 77/264 (29%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 76/259 (29%)
Tryp_SPc 41..266 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436965
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.