DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG17572

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:353 Identity:91/353 - (25%)
Similarity:146/353 - (41%) Gaps:64/353 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGLGAWGEIFCCPTKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRER 131
            |.:|.    .|.|...|  .:.|..|:.|.....|: :..|       ||.:......|......
  Fly    69 CSVGT----ECTPLHDC--TALIYEVARSCYYGDKS-LYCG-------GSSEELPYVCCPSSPLE 119

  Fly   132 KQQRSGNQLVI-HIVGGYPVDPGVYPHMAAIGYITFGTD---FRCGGSLIASRFVLTAAHC--VN 190
            |.|..|..||. |...|.    |.||.:|.||:....|.   :.|.|::||.|.:||||||  ..
  Fly   120 KNQVCGKSLVQGHFYKGL----GSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAK 180

  Fly   191 TDANTPAFVRLGAVNI-ENPD-------------HSYQDIVIRSVKIHPQY-VGNKYNDIAILEL 240
            .|.:..:.||:|..:. .:||             |:...::     :||.| .|..::|||:|.|
  Fly   181 ADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVI-----VHPDYKQGQYHHDIALLVL 240

  Fly   241 ERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYA 305
            :..:..:...:|.||.....:.....:..:||||.:: |:..|...:....:.|...|.|..:|.
  Fly   241 KTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMS-TSSVRQPEMSHLDVPLTSWDLCLRNYG 304

  Fly   306 -----EQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGF- 364
                 |.|.||.       ...:||..:.  .|.|:|..|.||..:   |:|:::.:|::|.|. 
  Fly   305 STGALESPNSIE-------GQWMCAGGEG--KDVCQGFGGAPLFIQ---ENGIFSQIGIMSFGSD 357

  Fly   365 GCATV-TPGLYTRVSSYLDFIEGIVWPD 391
            .|..: .|.:||.|:.:.::|.....|:
  Fly   358 NCGGLRIPSVYTSVAHFSEWIHDNTPPE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 3/11 (27%)
Tryp_SPc 143..384 CDD:214473 71/267 (27%)
Tryp_SPc 144..387 CDD:238113 71/269 (26%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 70/260 (27%)
Tryp_SPc 138..378 CDD:214473 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.