DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG9377

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:257 Identity:75/257 - (29%)
Similarity:116/257 - (45%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GVYPHMAAIGYITFGTD-FRCGGSLIASRFVLTAAHCV-NTDANTPAFVRL------GAVNIENP 209
            |.:|.:.|:    :|:| :.|.|:||....|:|.|||| |::...   |||      .||.:|..
  Fly   110 GEFPWLVAV----YGSDTYLCSGALITPLAVITTAHCVQNSEMEK---VRLLAGEWDAAVELEPQ 167

  Fly   210 DHSYQDIVIRSVKIHPQYVGNKY-NDIAIL--ELERDVVETDNIRPACLHTDATDPP----SNSK 267
            .|..:.:|  ...:||.|..... ::||||  :.|:......|::|.||     .||    :.|:
  Fly   168 PHQQRSVV--ETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL-----PPPRIMYNYSQ 225

  Fly   268 FFVAGWGVLNVTTRARSKIL-LRAGLELVPLDQCNISYAEQPGSIRL----LKQGVIDSLLCAID 327
            .:|:||   ..:...|:.|| .|..|.::|.|||..       .:||    .:....||||||..
  Fly   226 CYVSGW---QRSDFGRAAILPKRWTLYVLPPDQCRT-------KLRLSLLGRRHAHNDSLLCAGG 280

  Fly   328 QKLIADACKGD---SGGPLIHELNVEDGMYTIMGVISSGFGC-ATVTPGLYTRVSSYLDFIE 385
            .|  .|...||   :..||:..|:..|..:.:.|:::....| .....|:||.|..|..:|:
  Fly   281 DK--GDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWID 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 74/254 (29%)
Tryp_SPc 144..387 CDD:238113 75/257 (29%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 74/255 (29%)
Tryp_SPc 105..339 CDD:214473 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.