DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Jon25Bi

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:114/269 - (42%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVN--------------TDAN 194
            ||.|||...|..|:...:|:...| .:.||||:||..:|||||||.|              |:|.
  Fly    37 IVNGYPAYEGKAPYTVGLGFSGNG-GWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQ 100

  Fly   195 TPAFVRLGAVNIEN---PDHSYQDI-VIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACL 255
            ....|..|.. |:|   |:.:..|| :||:..:...::.||      :||               
  Fly   101 FTHTVGSGDF-IQNHNWPNQNGNDIALIRTPHVDFWHMVNK------VEL--------------- 143

  Fly   256 HTDATDPPSNSKF--------FVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIR 312
                  |..|.::        ...|||:  .|..::...:....|:::...:|:.:|..||    
  Fly   144 ------PSFNDRYNMYDNYWAVACGWGL--TTAGSQPDWMECVDLQIISNSECSRTYGTQP---- 196

  Fly   313 LLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVIS--SGFGCATVTPGLYT 375
                   |.:|| :........|.|||||||:    :.|| ..::||.|  ||.||....|..:|
  Fly   197 -------DGILC-VSTSGGKSTCSGDSGGPLV----LHDG-GRLVGVTSWVSGNGCTAGLPSGFT 248

  Fly   376 RVSSYLDFI 384
            ||::.||:|
  Fly   249 RVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 75/267 (28%)
Tryp_SPc 144..387 CDD:238113 76/269 (28%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 75/267 (28%)
Tryp_SPc 37..260 CDD:238113 76/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436997
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.