DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG31220

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:394 Identity:102/394 - (25%)
Similarity:151/394 - (38%) Gaps:106/394 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CRTSSDCEPL--------IDGYIKSGVLTLNDVPSCGLGA-----WGEIF-CCPTKPCCDNSTIT 90
            |....||.|:        :.|   |..:.::....||:..     :..|: ||| ||.   :|:.
  Fly    33 CIRLKDCRPIYYNVRRNRLSG---SAKVNISQTRMCGVSVRDRKRYKRIYICCP-KPA---NTLP 90

  Fly    91 SVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVY 155
            |.....     .|.|:.||                                   :||...:...|
  Fly    91 SYPDCG-----KPQTTNRV-----------------------------------IGGTEPNLNEY 115

  Fly   156 PHMAAIGY---ITFGTDFR----CGGSLIASRFVLTAAHCVNTDANTPAFVRLGA-VNIENPD-- 210
            |.:|.:.|   ..|..|..    ||||||.:|:||||||||.........||||. ....|||  
  Fly   116 PWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCI 180

  Fly   211 ---------HSYQDIVIRSVKIHPQYVGNKY---NDIAILELERDVVETDNIRPACLHTDATDPP 263
                     .::.||.:.|:..|..|....|   ||||::.|:..|..|....|.|:    .|.|
  Fly   181 SRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICV----LDYP 241

  Fly   264 SN---SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA 325
            .:   .|.:|||||...:.... ||:|..|.:::...::|:..||.:....|.        .:||
  Fly   242 RSLMKFKMYVAGWGKTGMFDTG-SKVLKHAAVKVRKPEECSEKYAHRHFGPRF--------QICA 297

  Fly   326 --IDQKLIADACKGDSGGPLIHELNVEDGMYTIM-GVISSGFGCATV-TPGLYTRVSSYLDFIEG 386
              :|.:   ..|.||||.||:..........|.: |:.|.|..|.|: .|.::||.:.:..:|..
  Fly   298 GGLDNR---GTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIRA 359

  Fly   387 IVWP 390
            .:.|
  Fly   360 HLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 10/52 (19%)
Tryp_SPc 143..384 CDD:214473 80/269 (30%)
Tryp_SPc 144..387 CDD:238113 81/271 (30%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 82/304 (27%)
Tryp_SPc 104..360 CDD:238113 82/306 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.