DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and sphinx1

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:292 Identity:48/292 - (16%)
Similarity:102/292 - (34%) Gaps:105/292 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NQLVIHIVGGYPVDPGVYPHMAAIGY-------ITFGTDFRCGGSLIASRFVLTAAHCVNTDANT 195
            |:|...|.|||........::..|.|       :.:|     .|::|:::::||....:.     
  Fly    20 NKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYG-----AGTIISNQWILTVKTVLK----- 74

  Fly   196 PAFVRLGAVNIENPDHSYQDIVIRS---------VKIHPQYVGNKYNDIAILELERDVVE----- 246
                           :||.::.:.|         ::|:.:.....|::..::.|.:...:     
  Fly    75 ---------------YSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFDRR 124

  Fly   247 TDNIRPACLHTDATDPPSNSKF--------FVAGWGVLNVTTRARSKILLRAGLELVPLDQCNIS 303
            .|.:|.         |..:::|        .|.|:|     |..|                    
  Fly   125 MDRVRV---------PAYDTRFERYVGNMTMVCGYG-----TEKR-------------------- 155

  Fly   304 YAEQPGSIRLLKQGVIDSLLCA------------IDQKLIADACKGDSGGPLIHELNVEDGMYTI 356
            :|:.|..:|.::..|:::..||            ...:.....|:||.||.::    ......|.
  Fly   156 HAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVV----TMGPNPTF 216

  Fly   357 MGVI-SSGFGCATVTPGLYTRVSSYLDFIEGI 387
            :|:| .....|:...|.::.|||.::.:|:.:
  Fly   217 IGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 45/282 (16%)
Tryp_SPc 144..387 CDD:238113 46/284 (16%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 45/282 (16%)
Tryp_SPc 26..248 CDD:304450 46/284 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.