DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and spirit

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:374 Identity:119/374 - (31%)
Similarity:186/374 - (49%) Gaps:62/374 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CKVTDT--MPGICRTSSDCEPLIDGYIKSGVLTLNDVP-SCGLGAWGEIFCCPTKPCCDNSTITS 91
            |::.|.  ..|.||...||...::|:::.     .:.| :|....:....||             
  Fly    51 CQLEDVARTKGTCRRMEDCPSALNGWLER-----RESPKTCYFVRFDHYVCC------------- 97

  Fly    92 VSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYP 156
                  ....||:.:            |.:..||.::.:..:.:..::..:.:|||.|..|..:|
  Fly    98 ------APAVAPIVT------------RSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFP 144

  Fly   157 HMAAIGYITFGTD----FRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIV 217
            .|||:|:.: ..|    :||||:|||:.||||||||.:.....|:.||||..|:...:.  :||.
  Fly   145 FMAALGWRS-NFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEG--EDIS 206

  Fly   218 IRSVKIHPQY-VGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTR 281
            ||.|.|||.| ....|||||:||||  ......::|.|:.|.  ...:|:.....|:|..:....
  Fly   207 IRRVIIHPDYSASTAYNDIALLELE--TAAKPELKPTCIWTQ--KEVTNTLVTAIGYGQTSFAGL 267

  Fly   282 ARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHE 346
            :.:: ||:..|:.|..::|...|.:..     |.|||:.:.:||.|.....|.|:|||||||:  
  Fly   268 SSAQ-LLKVPLKSVSNEECQHHYQKDQ-----LAQGVLGTQMCAGDITGERDTCQGDSGGPLL-- 324

  Fly   347 LNVEDGMY-TIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWPDNRV 394
              ::||:. .::|:.|.|.|||:..|.:||||||::|:|||||||..:|
  Fly   325 --MQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829 11/51 (22%)
Tryp_SPc 143..384 CDD:214473 94/246 (38%)
Tryp_SPc 144..387 CDD:238113 96/248 (39%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 12/70 (17%)
Tryp_SPc 132..364 CDD:238113 96/248 (39%)
Tryp_SPc 132..361 CDD:214473 94/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.