DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG11664

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:267 Identity:63/267 - (23%)
Similarity:96/267 - (35%) Gaps:84/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GYPVDPGVYPHMAAIGYI--TFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAF-VRLGAVNIEN 208
            |.||....|      ||:  .:|..|...|||.::|:|||.|||...:...... ||.|      
  Fly    26 GIPVQQQNY------GYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG------ 78

  Fly   209 PDHSYQDIV-------IRSVKIHPQYVG-NKYNDIAILELERDVVETDNI-------RPAC-LHT 257
                |:.|.       :..:..||::.. ...||||:|.::..:..:..|       ||.. |:.
  Fly    79 ----YRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNM 139

  Fly   258 DATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSL 322
            .|  ||..    :|||.::::....:|     ..:::.|...|...:.:..|.:           
  Fly   140 FA--PPQE----LAGWNLMHIAQPLKS-----MSVQVEPEKNCRQWFPQISGGV----------- 182

  Fly   323 LCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVT----------PGLYTRV 377
            :|| ...:....|.||||.||                ||.|..|....          |.|:|.|
  Fly   183 ICA-SATMGEGLCYGDSGDPL----------------ISGGEVCGLAIAFRKCGDKRYPALFTDV 230

  Fly   378 SSYLDFI 384
            ..:..||
  Fly   231 HYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 61/265 (23%)
Tryp_SPc 144..387 CDD:238113 63/267 (24%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 57/249 (23%)
Tryp_SPc 38..237 CDD:214473 55/247 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.