DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and GZMK

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:260 Identity:82/260 - (31%)
Similarity:122/260 - (46%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 IHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVN--TDANTPAFVRLGAV 204
            :.|:||..|.|...|.||:|.|   |....|||.||..::|||||||..  |...:|..| |||.
Human    25 MEIIGGKEVSPHSRPFMASIQY---GGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVV-LGAH 85

  Fly   205 NIENPDHSYQDIVIRS------VKIHPQYVGNKYNDIAILELERDVVETDNIRPACLH-TDATDP 262
            ::...:.|.|.:.|:.      |...||     .|||.:::|:.......:::  .|| ...|..
Human    86 SLSKNEASKQTLEIKKFIPFSRVTSDPQ-----SNDIMLVKLQTAAKLNKHVK--MLHIRSKTSL 143

  Fly   263 PSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAID 327
            .|.:|..|.|||..:..:...|..|....:.::....|| |.:...|...:.|     .::||.|
Human   144 RSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCN-SQSYYNGDPFITK-----DMVCAGD 202

  Fly   328 QKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVT-PGLYTRVS-SYLDFIEGIVWP 390
            .|...|:||||||||||.:     |::  ..::|.|..|...| ||:||.:: .|..:|:..:.|
Human   203 AKGQKDSCKGDSGGPLICK-----GVF--HAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVP 260

  Fly   391  390
            Human   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 80/251 (32%)
Tryp_SPc 144..387 CDD:238113 81/253 (32%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 80/251 (32%)
Tryp_SPc 27..257 CDD:238113 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.