DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and GZMA

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:268 Identity:73/268 - (27%)
Similarity:115/268 - (42%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFR--CGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI 206
            |:||..|.|...|:|     :....|.:  |.|:|||..:|||||||   :.|..:.|.|||.:|
Human    29 IIGGNEVTPHSRPYM-----VLLSLDRKTICAGALIAKDWVLTAAHC---NLNKRSQVILGAHSI 85

  Fly   207 ENPDHSYQDIVIRSVKIHPQYVG------------------NKYNDIAILELERDVVETDNIRPA 253
            ...:.:.|.::::....:|.|..                  |||  :.||.|.:   :.|:::|.
Human    86 TREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKY--VTILHLPK---KGDDVKPG 145

  Fly   254 CLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCN--ISYAEQPGSIRLLKQ 316
            .:..            |||||..: .:.:.|..|....:.::....||  ..|...|        
Human   146 TMCQ------------VAGWGRTH-NSASWSDTLREVNITIIDRKVCNDRNHYNFNP-------- 189

  Fly   317 GVID-SLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGF--GCATVT-PGLYTRV 377
             ||. :::||...:...|:|.||||.||:.|     |::  .||.|.|.  .|.... ||:|..:
Human   190 -VIGMNMVCAGSLRGGRDSCNGDSGSPLLCE-----GVF--RGVTSFGLENKCGDPRGPGVYILL 246

  Fly   378 S-SYLDFI 384
            | .:|::|
Human   247 SKKHLNWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 72/266 (27%)
Tryp_SPc 144..387 CDD:238113 73/268 (27%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 72/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.