DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG18636

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:320 Identity:90/320 - (28%)
Similarity:123/320 - (38%) Gaps:81/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MTSGRVDVPTF----------GSGDRPAVAACKKIRE-----RKQQRSGNQLVIHIVGGYPVDPG 153
            |.:..:.||||          .||       |.:..:     |.|.|:    ...|:.|:.....
  Fly     1 MHTALIGVPTFVGIILMFQLLHSG-------CSQFLDPACGIRTQSRT----AYRIINGHTAKYN 54

  Fly   154 VYPHMAAIGYITFGTD-FRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDH--SY-- 213
            ..|.|.   ::...|| |.||||||..:.|||||||.  .||.....|||.......:.  .|  
  Fly    55 SSPWMV---FLHSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLVARLGEYERTRSEECTGYYC 114

  Fly   214 ----QDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACL--------HTDATDPPSN 265
                :.:|....| |..|..|.: ||||||.|.:.||..|||||.|:        :.|..|    
  Fly   115 NFREEHMVDAGFK-HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID---- 174

  Fly   266 SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA--IDQ 328
             .....|||  .....:.|..|....:...|.|.|          .:.:.|.:..:..||  .|.
  Fly   175 -LLTATGWG--KTQMESDSDALQTLDIRRQPPDVC----------AKFIGQTIAGNQFCAGNWDS 226

  Fly   329 KLIADACKGDSGGPL---IHELNVEDGMYTIMGVIS-SGFGCATVTPGLYTRVSSYLDFI 384
            .|    |.|||||||   |...|.:  .:..:|:.| :...|...:  ::|.|.|:.:||
  Fly   227 NL----CNGDSGGPLGAVITHKNTQ--RFVQVGIASYTNRNCQKAS--VFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 77/264 (29%)
Tryp_SPc 144..387 CDD:238113 79/265 (30%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/264 (29%)
Tryp_SPc 45..278 CDD:238113 77/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.