DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG30323

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:301 Identity:64/301 - (21%)
Similarity:103/301 - (34%) Gaps:82/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RSGNQLVIHIVGGYPVDPGVYPHMAAIGYIT------FGTDFRCGGSLIASRFVLTAAHCVNT-D 192
            :.|.|..:::...|        |...:...|      :|.:..|.|||:::.:|:|:..||:| .
  Fly    19 KKGLQRNLYVTDNY--------HQNVVSIRTRKHIRHWGDNHFCAGSLLSAWWVVTSGCCVSTRP 75

  Fly   193 ANTP------------AFV--RLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERD 243
            .:||            .|.  ||...:.:|..| .|.||:....|      :...::|:|:|:|.
  Fly    76 ESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYH-VQKIVLDESAI------SGCTELALLKLDRG 133

  Fly   244 VVETDNIRPACLHTDATDPPSNSKFFV--AGWGVLNVTTRARSKILLRA---------------- 290
            |.   ..|.|.:   ..:...||.:..  .|||.:...:......:..|                
  Fly   134 VT---GQRFAMM---LPEKELNSTWLCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGP 192

  Fly   291 -GLELVPLDQCNIS-YAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGM 353
             ..||:.:....|| |..:|...|         .||........:.|:.|.|.||..:       
  Fly   193 YSSELIQIRAQKISEYECKPDCSR---------CLCMTSYTGRGNMCQQDLGSPLFCD------- 241

  Fly   354 YTIMGVISSGFGCATVTPGLYTRVSSYLDFIE----GIVWP 390
            :.:.||......|.......||.:.....|||    |..||
  Fly   242 HFLYGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLSGATWP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 56/281 (20%)
Tryp_SPc 144..387 CDD:238113 59/287 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 56/258 (22%)
Tryp_SPc 45..272 CDD:214473 53/255 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.