DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG30286

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:111/250 - (44%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN-----------P 209
            |.||   |:....:..|||:|:..||:||||||:..|.|..  ||||..|...           |
  Fly    47 PWMA---YLHKSGELVCGGTLVNHRFILTAAHCIREDENLT--VRLGEFNSLTSIDCNGSDCLPP 106

  Fly   210 DHSYQ-DIVIRSVKIHPQYV-GNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNS---KFF 269
            ...:: |:..|    |..|. .|:.:||.:|.|.:.|....:|:|.||.|:.|..|...   :..
  Fly   107 SEDFEIDVAFR----HGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLV 167

  Fly   270 VAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVID---SLLCAIDQKLI 331
            ..|||  ...:.|.:.||....:..|....|:.:|             .:|   ..:|...:..:
  Fly   168 ATGWG--RSPSEAANHILKSIRVTRVNWGVCSKTY-------------WVDRRRDQICVSHESGV 217

  Fly   332 ADACKGDSGGPLIHELNVEDG--MYTIMGVISSGFGCATVTPGLYTRVSSYLDFI 384
              :|.||||||:...:.: ||  ::..:|::|.| ....::|.::|.|..::|:|
  Fly   218 --SCSGDSGGPMGQAIRL-DGRVLFVQVGIVSYG-NAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 68/248 (27%)
Tryp_SPc 144..387 CDD:238113 68/249 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 68/249 (27%)
Tryp_SPc 39..268 CDD:214473 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.