DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG30187

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:263 Identity:85/263 - (32%)
Similarity:126/263 - (47%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHC-VNTDANTPA 197
            |..|..:.:.|.||:   ...:.:...:..:...|.|.|||:||..||||||||| |:.|..:  
  Fly    26 QICGINIALKITGGH---NAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQS-- 85

  Fly   198 FVRLGAVNIENPDHSYQDIVIRSVKIHPQY-VGNKY-NDIAILELERDVVETDNIRPAC--LHTD 258
             |.|||.|..:| ...:|::  :..:|..: |...| |||.:|:|..||:....|||.|  |:..
  Fly    86 -VSLGAYNKSDP-ADRKDVI--TAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKS 146

  Fly   259 ATDPPSNSKFFVA-GWGVL--NVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVID 320
            ..:...|.:.|.| |||.|  |.|    |.||....|..:..::|.:..:..|..    ||    
  Fly   147 MANHMRNMRTFKAFGWGTLRGNKT----SDILQTIILNHLDREECYMELSVYPSE----KQ---- 199

  Fly   321 SLLCAIDQKLIADACKGDSGGPLIHELNVED-GMYTI-MGVISSG-FGCATVTPGLYTRVSSYLD 382
              :||....  .|.|.|||||||.:::.::. |...: .|:||.| ..|.  ..|:||.:.|:.|
  Fly   200 --ICAGVPS--GDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCD--GQGVYTDLMSFAD 258

  Fly   383 FIE 385
            :|:
  Fly   259 WIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 82/251 (33%)
Tryp_SPc 144..387 CDD:238113 83/253 (33%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 82/251 (33%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.