DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG30083

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:257 Identity:89/257 - (34%)
Similarity:123/257 - (47%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTD-----FRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGA 203
            |:.|...:.|..|.||   ||....|     ..|||:||..:|||:||||:..|....  |||| 
  Fly    34 IMHGQNAENGTNPWMA---YIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILA--VRLG- 92

  Fly   204 VNIENPDHSYQDIVIRSVKIHPQY--VGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNS 266
                  :||.......:.....:|  .|:..|||.||.::..|.....|||.|:.||.|..|:..
  Fly    93 ------EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVK 151

  Fly   267 KFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLI 331
            .|..||||  .......||:     |:.|.|::.|.|..     ..:|...|.:|.:||....  
  Fly   152 TFKAAGWG--KTENETFSKV-----LKTVELNELNASEC-----YNMLWVNVTESQICAGHPD-- 202

  Fly   332 ADACKGDSGGPLIHELNVEDGM-YTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWPDN 392
            .|.|.|||||||||.:.::..: |..:|:||.|..... :||:|||:||::|:|..:|  ||
  Fly   203 GDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCN-SPGVYTRLSSFIDWILMVV--DN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 85/247 (34%)
Tryp_SPc 144..387 CDD:238113 86/250 (34%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 85/247 (34%)
Tryp_SPc 34..255 CDD:238113 85/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.