DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG30082

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:270 Identity:87/270 - (32%)
Similarity:129/270 - (47%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAF----VRLGAV 204
            ||||...|.|..|.:|   |:...:...|.|:||..|||||||||::      :|    ||||..
  Fly    40 IVGGRTADIGSNPWLA---YLHKNSSLVCTGTLITKRFVLTAAHCLH------SFHLLTVRLGEY 95

  Fly   205 NIEN----------PDHSYQDIVIRSVKIHPQYVG--NKYNDIAILELERDVVETDNIRPACLHT 257
            :...          |  :|::..:.:..||..:.|  :..|||.:|:|...||....|||.||..
  Fly    96 DTSTRIDCTSEFCIP--TYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFR 158

  Fly   258 DATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSL 322
            |....|.:|.:..||||.:::...|   .:|:. :.|:.|||.:..        |.|:..:....
  Fly   159 DPGQVPYSSTYEAAGWGKIDLINTA---TVLQT-VNLIRLDQSDCE--------RSLRTSLSYGQ 211

  Fly   323 LCAIDQKLIADACKGDSGGPLIHELNVEDGMYT---IMGVISSG-FGCATVTPGLYTRVSSYLDF 383
            .||...:  ||.|.|||||||..:::  :|..|   .:|::|.| :.|.  .||:||.|.|:.::
  Fly   212 FCAGQWR--ADTCSGDSGGPLSRKMS--NGRITRTVQLGIVSYGHYLCR--GPGVYTYVPSFTNW 270

  Fly   384 IEGIV-WPDN 392
            |..|. |..|
  Fly   271 ILSITRWTQN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 83/259 (32%)
Tryp_SPc 144..387 CDD:238113 84/262 (32%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 83/259 (32%)
Tryp_SPc 40..274 CDD:238113 84/262 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.