Sequence 1: | NP_573297.1 | Gene: | psh / 32832 | FlyBaseID: | FBgn0030926 | Length: | 394 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492773.3 | Gene: | T22A3.6 / 188711 | WormBaseID: | WBGene00011909 | Length: | 491 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 42/199 - (21%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 57/199 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 PVDPGVYPHMAAIGYITFGTDFR-CGGSL-IASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDH 211
Fly 212 SYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVET--DNIR----PACLHTDATDPPSNSKFFV 270
Fly 271 AG----WGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLI 331
Fly 332 ADAC 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
psh | NP_573297.1 | CLIP | 30..79 | CDD:197829 | |
Tryp_SPc | 143..384 | CDD:214473 | 42/199 (21%) | ||
Tryp_SPc | 144..387 | CDD:238113 | 42/199 (21%) | ||
T22A3.6 | NP_492773.3 | KR | 98..173 | CDD:350900 | 6/24 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |