DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and T22A3.6

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:199 Identity:42/199 - (21%)
Similarity:73/199 - (36%) Gaps:57/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PVDPGVYPHMAAIGYITFGTDFR-CGGSL-IASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDH 211
            |:.|..|     :|..|....|: |..|. .:|.||     |:|.|.                 .
 Worm   153 PLGPWCY-----VGNDTTAPCFQPCRPSTETSSDFV-----CLNRDG-----------------F 190

  Fly   212 SYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVET--DNIR----PACLHTDATDPPSNSKFFV 270
            .|.|..:..:...||.:| .:.|:.::...|.|:.:  |.::    .:|:          :|..:
 Worm   191 PYTDYDMSDILDLPQLIG-IFKDVDLMYESRFVLPSLPDGVQRLSTKSCI----------NKGHI 244

  Fly   271 AG----WGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLI 331
            |.    |  :.|..:..::.|..||...: .|.|..|:.|.  .|...:||::  |...|:.:|.
 Worm   245 ANHFGPW--IAVLDQTATQFLAAAGRRKL-RDLCFPSFNEH--EIFTYQQGIL--LDAIIEDELT 302

  Fly   332 ADAC 335
            ...|
 Worm   303 ISGC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 42/199 (21%)
Tryp_SPc 144..387 CDD:238113 42/199 (21%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.