DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and try-4

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:282 Identity:70/282 - (24%)
Similarity:114/282 - (40%) Gaps:83/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 AIGYITFGTDFRCGGSLIASRFVLTAAH------------CVNTDANTP--------AFVR---- 200
            |:.:...|.: |.|||:|:...::||||            |.|.:...|        .|:|    
 Worm    61 AVSFTVDGVN-RLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTRK 124

  Fly   201 --LGAVNIENPDHSY--------QDIV---IRSVKIHPQYVGN---KYNDIAILELERDVVETDN 249
              .|...|......|        .|::   :|:|.:..::..:   |.:|.||:|:|:.:..::|
 Worm   125 VAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSEN 189

  Fly   250 IRPACLHTDATDPPSNSKFF-----VAGWGVLNVTTRARSKILLRAG--LELVPL---DQCNISY 304
            :||.||       |..:.::     |.|||        ||.|...:|  :..:|:   ..|    
 Worm   190 VRPICL-------PRPNMYYTKSLAVPGWG--------RSYIFNESGPLIHEIPMRIDRDC---- 235

  Fly   305 AEQPGSIRLLKQGVIDSLLCAIDQKL----IADACKGDSGGPLIHELNVED--GMYTIMGVISSG 363
             ::|.|.||....  |..:||....:    ....|.|||||.|.:.   :|  |...::.:.|.|
 Worm   236 -KRPWSDRLPADA--DDFICATSMNVSNYSAPRTCHGDSGGGLEYR---DDNYGRAFLIAITSFG 294

  Fly   364 F-GCATVTPGLYTRVSSYLDFI 384
            . ||.:.....:|||..||:.|
 Worm   295 TRGCPSNMLARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 69/280 (25%)
Tryp_SPc 144..387 CDD:238113 70/282 (25%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 70/282 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.