DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and try-3

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:265 Identity:75/265 - (28%)
Similarity:120/265 - (45%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208
            |:||..:|.|.......:.|...|....||.::|...:::|||||. ....|.:|     |.:..
 Worm    38 IIGGNSIDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCA-LQLQTRSF-----VYVRE 96

  Fly   209 PDHSYQDIVIRSVKIHPQYVGNKY------NDIAILELERDVVETDNIRPACL-HTDATDPPSNS 266
            |.::.:    ||..:...|:.:.|      ||||:|.:..|:.:. .|:|.|| |.|:.......
 Worm    97 PKNNRE----RSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKL-GIKPVCLVHDDSKLLKQYK 156

  Fly   267 KFFVAGWGV-LNVTTRARSKILLRAGLE--LVPL---DQCNISYAEQPGSIRLLKQGVIDSLLCA 325
            ...|.|:|: |...:....|::....|:  .||:   |.|..::.    .:.||...:....:||
 Worm   157 NGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWR----FLSLLSVKITGYQICA 217

  Fly   326 IDQKLIADACKGDSGGP-LIHELNVEDGMYTIMGVISSGF-GCATVT-----PGLYTRVSSYLDF 383
              ...:.....|||||| |||:.|   |.|..:|:.|.|. |...|.     ||:|||:|.|:.:
 Worm   218 --GAYLHGTAPGDSGGPLLIHKSN---GEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPW 277

  Fly   384 IEGIV 388
            |:|::
 Worm   278 IQGVI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 73/259 (28%)
Tryp_SPc 144..387 CDD:238113 74/262 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.