DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and Gzmk

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:254 Identity:73/254 - (28%)
Similarity:117/254 - (46%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVN--TDANTPAFVRLGAVNI 206
            |:||..|.|...|.||:|.|   .:...|||.||..::|||||||.:  ...::|..| |||.::
Mouse    26 IIGGREVQPHSRPFMASIQY---RSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVV-LGAHSL 86

  Fly   207 ENPDHSYQDIVIRS-VKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATD-PPSNSKFF 269
            ...:...|...|:. :.......|:..:||.:::|........|::  .||..:.: ....:|..
Mouse    87 SKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQ--LLHLGSKNYLRDGTKCQ 149

  Fly   270 VAGWGVLNVTTRARSKILLRAGLELVPLDQCNI-SYAEQPGSIRLLKQGVIDSLLCAIDQKLIAD 333
            |.|||.........|..|....:.::...:||. ||...       |..:...::||.|.:...|
Mouse   150 VTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNH-------KPVITKDMICAGDARGQKD 207

  Fly   334 ACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATV-TPGLYTRVS-SYLDFIEGIVWP 390
            :||||||||||.:     |::  ..::|.|:.|... .||:||.:: .|..:|:..:.|
Mouse   208 SCKGDSGGPLICK-----GIF--HALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 71/246 (29%)
Tryp_SPc 144..387 CDD:238113 72/249 (29%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 71/246 (29%)
Tryp_SPc 26..256 CDD:238113 72/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.