DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG43742

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:235 Identity:78/235 - (33%)
Similarity:110/235 - (46%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TDFRCGGSLIASRFVLTAAHCV-NTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKI--HPQYVG 229
            ::|.||||||..::|||||||| :.|..|   |.||..|...|....:.::..:.|:  ||.:.|
  Fly    54 SEFFCGGSLIHKQYVLTAAHCVRDLDEVT---VHLGENNRSCPIPVCKHVLRLNAKVILHPNFHG 115

  Fly   230 NKY-NDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVA-GWGVL---NVTTRARSKILLR 289
            |.: ||||:|.|||:|:...:|||.|:..|.....:|...|.| |||..   |:     |.:|..
  Fly   116 NIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYGWGKTEHGNI-----SDVLSF 175

  Fly   290 AGLELVPLDQC--NISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLI----HELN 348
            ..|..:|...|  ||                  :.:||  .....|.|:.|||||||    |...
  Fly   176 IDLVRLPKSMCYQNI------------------NTICA--GSTSGDTCESDSGGPLIGNFVHRGK 220

  Fly   349 VEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIV 388
            ..|   .:.|:.|.|....:...|:||.|::|..:|..:|
  Fly   221 SRD---ILFGITSYGDAECSGLFGVYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 76/229 (33%)
Tryp_SPc 144..387 CDD:238113 77/232 (33%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 76/229 (33%)
Tryp_SPc 35..256 CDD:238113 77/232 (33%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.