DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG43110

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:260 Identity:95/260 - (36%)
Similarity:125/260 - (48%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 QQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPA 197
            :|..|...|..|:.|.........:||.| :.|  |...|||::|...||||.|||.:|..   .
  Fly    25 KQPCGKTPVPKIISGSNASQQSAQYMAGI-FNT--THLLCGGTIIHEDFVLTVAHCKSTQT---L 83

  Fly   198 FVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATD 261
            ||||||.||.:|....:  ||.:: .||||..:.| ||||:::|||.|:...||:|.|:|.|||.
  Fly    84 FVRLGAYNINHPTDQIR--VIETI-AHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATL 145

  Fly   262 PPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA- 325
            ......:...|||  ......:|.||.|..:.......|::.....|..    ||      :|| 
  Fly   146 GKQIRYYNAFGWG--RTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDP----KQ------ICAT 198

  Fly   326 IDQKLIADACKGDSGGPLIHELNVEDGMY-TIMGVISSGF-GCATVTPGLYTRVSSYLDFIEGIV 388
            .||   .|.|.||||||||.::..:...: |..|:.|.|. .|..|  ||||.||.|..:|..||
  Fly   199 TDQ---GDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGV--GLYTDVSQYSGWIANIV 258

  Fly   389  388
              Fly   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 89/244 (36%)
Tryp_SPc 144..387 CDD:238113 90/246 (37%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 89/244 (36%)
Tryp_SPc 36..257 CDD:238113 90/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.