DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG43124

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:87 Identity:29/87 - (33%)
Similarity:43/87 - (49%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 CGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIH---PQYVGNKYN 233
            |.|:||.:.:|||||.|..  .|....||||:...   |.||::  .|..|.:   ..:..|..|
  Fly    54 CAGALINNLYVLTAASCFK--ENEKLTVRLGSGYF---DKSYEN--FRVTKAYFWMTHFPANNTN 111

  Fly   234 DIAILELERDVVETDNIRPACL 255
            ::.|..|:.:|....:|||.|:
  Fly   112 NLCIFRLQTEVEFKTHIRPMCI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 29/87 (33%)
Tryp_SPc 144..387 CDD:238113 29/87 (33%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 28/85 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.