DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and CG42694

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:110/247 - (44%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSY--QDIVI 218
            |....:.:|:.||...|.||||:.:|||:||.|:  |.:...||:||..|.....|.|  .::||
  Fly    42 PQAGWLAHISNGTHVLCSGSLISKQFVLSAAQCI--DVHGKLFVQLGVSNATKSPHWYTVSNVVI 104

  Fly   219 RSVKIHPQYVGNK-YNDIAILELERDVVETDNIRPAC--LHTDATDPPSNSKFFVAGWGVL-NVT 279
                  |.:.|.: ..||.:|:|.:.|...|.:.|.|  |:|:..|...          :| |.|
  Fly   105 ------PSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVK----------ILQNFT 153

  Fly   280 TRA---RSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGG 341
            |.|   ::|......|..:..|:|.::          |...|....:||...:. .::|..|||.
  Fly   154 TSAWLSKNKNPQTIVLSQLSRDRCKLN----------LSGNVTPKEICAASLQR-NNSCFIDSGS 207

  Fly   342 ----PLIHELN-VEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIV 388
                |:|...| |.:.::.|.|.::....|:  .|.:|..|:..:.:||.:|
  Fly   208 ALTQPIIQGSNIVREMLFGIRGYVNGRSWCS--EPAIYIDVAECVGWIETVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 65/241 (27%)
Tryp_SPc 144..387 CDD:238113 67/244 (27%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 66/240 (28%)
Tryp_SPc 46..253 CDD:214473 64/237 (27%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.