DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and LOC101733035

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_031749230.1 Gene:LOC101733035 / 101733035 -ID:- Length:216 Species:Xenopus tropicalis


Alignment Length:198 Identity:51/198 - (25%)
Similarity:80/198 - (40%) Gaps:51/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 FVRLGAVNIENPDHSYQDI---VIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDA 259
            :..|||.|:......|..:   :|....|:|.|    |.:||:|||..|                
 Frog    16 YAALGAYNLTERKQFYIPVSRTIIHDRYIYPVY----YYNIALLELSTD---------------- 60

  Fly   260 TDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLC 324
                ||...|                ||..:.::|:.|::|...|.|...:|.     :.|::.|
 Frog    61 ----SNQLPF----------------ILQESEVQLISLERCRDLYREAYTNIL-----IADTMTC 100

  Fly   325 AIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVW 389
            |:|.........||.||||:.:   :.|.:.::||:|.........|..||.|.:|:|:|...|:
 Frog   101 AMDIHENTGISTGDLGGPLVCQ---KGGQWFLVGVVSLEVILELTLPVSYTSVPAYMDWINKHVF 162

  Fly   390 PDN 392
            |.|
 Frog   163 PPN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 47/188 (25%)
Tryp_SPc 144..387 CDD:238113 48/191 (25%)
LOC101733035XP_031749230.1 Tryp_SPc <19..160 CDD:419748 48/188 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.