DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and XB5962685

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:246 Identity:68/246 - (27%)
Similarity:107/246 - (43%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIEN 208
            |.||....|....:||   .:..|::. |||:||...:|||||.| ..|..|.  |.||..:|:.
 Frog    23 ITGGKEAIPHARRYMA---LVRTGSNL-CGGTLIKDNWVLTAATC-KVDRTTT--VDLGVHSIKT 80

  Fly   209 PDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAG 272
            .:...|...:.....|.::....| |::.:|:|......:..:....|.|...|....:....||
 Frog    81 MNKLRQQFKVARWVPHQKFDRRSYVNNLQLLQLSSKANFSYAVNILLLPTKYKDIKPGTVCETAG 145

  Fly   273 WGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKG 337
            ||:.....:.:|..|:...|.::...|||..:..:   |::.|     .::|..| |.....|.|
 Frog   146 WGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWKSK---IKITK-----DMMCTRD-KGKRGFCNG 201

  Fly   338 DSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPG--LYTRV-SSYLDFIE 385
            |.|||||..       ..:.||||.|.....:..|  :|||: |:|:.:|:
 Frog   202 DGGGPLICN-------RILTGVISFGPLICGMENGANVYTRLTSNYIKWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 67/243 (28%)
Tryp_SPc 144..387 CDD:238113 68/246 (28%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.