DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and gzma

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:266 Identity:81/266 - (30%)
Similarity:121/266 - (45%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LVIHIVGGYPVD--------PGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTP 196
            |:|||.|...:|        ....|:||.| |...|:   |||:||...:||||||||..::.  
 Frog    23 LLIHINGNICMDIIDGREAASHSRPYMAYI-YSRTGS---CGGTLIKQNWVLTAAHCVVNNSE-- 81

  Fly   197 AFVRLGAVNIENPDHSYQDIVIRSVKIHPQYV-GNKYNDIAILELERDVVETDNIRPACLHTDAT 260
              |.|||..:::.::..|...:.....||.:. ..|.:||.:|:::........:....|.|...
 Frog    82 --VILGAHKVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDM 144

  Fly   261 DPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA 325
            |....|....|||||.....:..|.:|....:.:|....||..|       :..|..:..::|||
 Frog   145 DVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIY-------KKFKTEISTNMLCA 202

  Fly   326 -----IDQKLIADACKGDSGGPLI--HELNVEDGMYTIMGVISSGFGCATVT-PGLYTRVSS-YL 381
                 .|:|.  |||:||||||||  .|.:         |::|.|..|.... ||:|||::: ||
 Frog   203 GAPKKSDKKY--DACQGDSGGPLICGKEFS---------GIVSFGKKCGDPKYPGIYTRLTARYL 256

  Fly   382 DFIEGI 387
            .:|..:
 Frog   257 QWIRDV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 78/258 (30%)
Tryp_SPc 144..387 CDD:238113 78/260 (30%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 75/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.