DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psh and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:254 Identity:69/254 - (27%)
Similarity:111/254 - (43%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHC-VNTDANTPAFVRLGAVNIE 207
            ||.|....|...|:|.:   :.......|||.|::.:||:||||| ||....|   |.:||    
Zfish    25 IVNGNEARPHSRPYMVS---VQCNRKHICGGFLVSEQFVMTAAHCFVNGKELT---VVVGA---- 79

  Fly   208 NPDHSYQD----IVIRSVKIHPQYVGNK-YNDIAILELERDVVETDNIRPACLHTDATDPPSNSK 267
               |.|.|    :.::...|||.:.... .|||.:|:|.:.|.:::.:....:.....|..:.:|
Zfish    80 ---HEYTDGASRMDVKFYHIHPGFESKTLLNDIMLLQLHKKVKKSNKVNWIPIPNADKDIKAKTK 141

  Fly   268 FFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIA 332
            ..||||| .|.|....|..|:...:.|.....|...:.....:.:::..|.....          
Zfish   142 CSVAGWG-KNTTHGEVSAKLMEVNVTLFDKKACQKYWGPTYSTSKMMCTGGHGGF---------- 195

  Fly   333 DACKGDSGGPLIHELNVEDGMYTIMGVIS--SGFGCATVT-PGLYTRVSSYLDFIEGIV 388
              |:|||||||:.:       ...:|::|  ....|.:.| |.:||::|.:|.:|:.||
Zfish   196 --CQGDSGGPLVCD-------KVAVGIVSFNEKNNCDSPTKPNVYTQISKFLSWIKCIV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 66/248 (27%)
Tryp_SPc 144..387 CDD:238113 67/251 (27%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 66/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.