DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Prss8

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:271 Identity:78/271 - (28%)
Similarity:128/271 - (47%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 AACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNS 433
            |:|      |..:...|..|.....|.:|...:|.|:  |:..  |||||:::::|::||||...
Mouse    35 ASC------GAVIQPRITGGGSAKPGQWPWQVSITYD--GNHV--CGGSLVSNKWVVSAAHCFPR 89

  Fly   434 DDSTPSF-VRLGALNIENPEPGYQDINVI----DVQIHPDYSGSSKYYDIAILQLAEDAKESDVI 493
            :.|..:: |:|||..:::    |.:..|:    .:..|..|.......|||:::|:.....|..|
Mouse    90 EHSREAYEVKLGAHQLDS----YSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYI 150

  Fly   494 RPACLYTDRSDPPANYKYFVAGWG-VMNVTNRAVSKILLRAALDLVPADECNASF-----AEQPS 552
            ||.||....:..|......|.||| |....:....:.|.:..:.|:..:.|:..:     .|:| 
Mouse   151 RPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEP- 214

  Fly   553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGC-ATKTPGL 616
              .|:::    ..|||......||||||||||||..   .::|.:.:.|::|.|..| |...||:
Mouse   215 --HTIQQ----DMLCAGYVKGGKDACQGDSGGPLSC---PMEGIWYLAGIVSWGDACGAPNRPGV 270

  Fly   617 YTRVSSFLDYI 627
            ||..|::..:|
Mouse   271 YTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 74/254 (29%)
Tryp_SPc 385..630 CDD:238113 75/255 (29%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 75/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.