DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG18754

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:113/265 - (42%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 DRGV-------YPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCV-----NSDDSTPSFVRLG 444
            |||.       ||.|..:.|.:          .|...|:||||||||     ..:|.....||||
  Fly   106 DRGAENAELNEYPWMVLLLYEN----------RLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLG 160

  Fly   445 -----ALNIENPEPGYQDINVIDVQIHPDYSGSSKYY--DIAILQLAEDAKESDVIRPACLYTDR 502
                 .:..|:..| :.|:.|....:|..::.|...|  |||:|:|....:.:..|:|.|| .|.
  Fly   161 ESTTDCITSESRCP-HLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL-LDA 223

  Fly   503 SDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLC 567
            ..|..:....::||.    ..::...::.....:..|||..|    ..||...       |||:|
  Fly   224 EFPLQDLNLQISGWD----PTKSSQTLITSTVKERNPADCLN----RYPSFRS-------ASQVC 273

  Fly   568 AADKNQRK-DACQGDSGGPLI-LEIDDVDGTYSIVGVISSG--FGCATKTPGLYTRVSSFLDYIE 628
            |.  .||| |.|.|.||.|:: :....||....:.|:.|.|  :..:...||:||::..|.::|:
  Fly   274 AG--GQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

  Fly   629 GIVWP 633
            ..:.|
  Fly   337 ANLAP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 72/257 (28%)
Tryp_SPc 385..630 CDD:238113 73/260 (28%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 71/258 (28%)
Tryp_SPc 108..335 CDD:214473 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.